DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl2a

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001003732.1 Gene:fhl2a / 445277 ZFINID:ZDB-GENE-040808-49 Length:279 Species:Danio rerio


Alignment Length:161 Identity:53/161 - (32%)
Similarity:79/161 - (49%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   648 SWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMN 712
            |||..||.|..|::.:....:..:|...||...:.:....:|..|.:.|.....|..: :.||.:
Zfish   121 SWHETCFTCQRCQQPIGTKSFIPKDNHNYCVPCYEKQ
FAMQCVHCKKPITTGGVTYHD-QPWHKD 184

  Fly   713 HFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQGQ--MSHDGQHWHATDE 775
            .|.|..|.:||.|||:..|:...|||:||..::|:.|..|...|....|.  :|.:.:.||  ::
Zfish   185 CFLCTGCKQQLSGQRFTSRDDFAYCLNCFCNLYA
KKCASCTSPISGLGGSKYISFEERQWH--ND 247

  Fly   776 CFSCNTCRCSLLGRAFLPRRGAIYCSIACSK 806
            ||:|..|..||:||.||..|..|.|. .|.|
Zfish   248 CFNCKKCSVSLVGRGFLTDRDDILCP-ECGK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 10/33 (30%)
LIM2_Prickle 687..742 CDD:188802 19/54 (35%)
LIM3_Prickle 747..805 CDD:188804 20/59 (34%)
fhl2aNP_001003732.1 LIM <7..33 CDD:295319
LIM1_FHL2 36..97 CDD:188806
LIM2_FHL2 101..157 CDD:188810 10/35 (29%)
LIM3_Fhl2 162..218 CDD:188815 20/56 (36%)
LIM 221..278 CDD:295319 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.