DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl1a

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:215 Identity:64/215 - (29%)
Similarity:99/215 - (46%) Gaps:21/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   607 RDAL-GRGNVRQLMSARP-CDGCDDLISTGDIAVFATRLGPNAS--------WHPACFACSVCRE 661
            ||.| |:..|::  ..:| |..|.|.:.....|.....:|.:|.        ||..||.|:.|.:
Zfish    27 RDNLQGKKYVKK--DDKPVCVRCFD
KLCANTCAECRKPIGADAKELNHKNRHWHEGCFRCAKCYK 89

  Fly   662 LLVDLIYFHR-DGRMYCGRHHAETLKPRCSACDEIILADEC--TEAEGRAWHMNHFACHECDKQL 723
            .|.:..:..: ||::.||:.......|||..|.::| ...|  .|.:.:.||...|.|.||.:.:
Zfish    90 PLANEPFQAKDDGKIMCGKCG
DRDGSPRCQGCYKVI-TPGCKNVEYKHKVWHEECFTCFECKQPI 153

  Fly   724 GGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLG 788
            ..|.::.:....||..|.:..||::|..|.|||  ..|.:::..|.||:  |||.|:||:..|.|
Zfish   154 RTQSFLTKGDDMYCTPCHEKKF
AKHCVRCKEAI--TSGGLTYQDQPWHS--ECFVCHTCKKPLAG 214

  Fly   789 RAFLPRRGAIYCSIACSKGE 808
            ..|.......|| :.|.|.:
Zfish   215 ARFTAHEDQFYC-VDCYKSD 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 5/11 (45%)
LIM1_Prickle 624..682 CDD:188799 17/66 (26%)
LIM2_Prickle 687..742 CDD:188802 17/56 (30%)
LIM3_Prickle 747..805 CDD:188804 20/57 (35%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319 8/23 (35%)
LIM1_FHL1 56..110 CDD:188730 14/53 (26%)
LIM2_FHL1 118..175 CDD:188808 15/57 (26%)
LIM3_FHL1 179..231 CDD:188813 21/56 (38%)
LIM4_FHL1 234..297 CDD:188734 64/215 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.