DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl1b

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_954687.1 Gene:fhl1b / 387528 ZFINID:ZDB-GENE-031219-1 Length:280 Species:Danio rerio


Alignment Length:187 Identity:59/187 - (31%)
Similarity:86/187 - (45%) Gaps:10/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 ARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETL 685
            |..|..|...|||....:.    .....||..||.|:.|.:.|....:..:|.|:.||...:...
Zfish    37 ANTCTECRRTISTDSKELH----HKGKYWHSDCFRCAKCYKNLAKESFTSKDDRILCGTCSSRED 97

  Fly   686 KPRCSACDEIIL-ADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYC 749
            .|||..|.:.|| ..|..|.:|.:||...|.|::|.|.:|.:.:|.:....||..|.:..||:.|
Zfish    98 APRCHGCYKPILPGTENVEYKGNSWHDECFKCYQCQKPIGNKSFITKNNNVYCSPCHEKKFAKQC 162

  Fly   750 DYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSK 806
            ..|.:.|  ..|.:::..|.||:  |||.|::||..|.|..|......:|| :.|.|
Zfish   163 ACCKKPI--TTGGVNYQDQPWHS--ECFVCSSCRKPLAGTRFTSHEEKVYC-VDCYK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 16/57 (28%)
LIM2_Prickle 687..742 CDD:188802 20/55 (36%)
LIM3_Prickle 747..805 CDD:188804 18/57 (32%)
fhl1bNP_954687.1 LIM1_FHL1 40..93 CDD:188730 16/56 (29%)
LIM2_FHL1 101..158 CDD:188808 18/56 (32%)
LIM3_FHL1 162..214 CDD:188813 19/56 (34%)
LIM4_FHL1 217..280 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.