DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Scel

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_006252490.1 Gene:Scel / 361086 RGDID:1305102 Length:672 Species:Rattus norvegicus


Alignment Length:339 Identity:77/339 - (22%)
Similarity:111/339 - (32%) Gaps:131/339 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 EPEVATGAA-QQESNEPIS--RTPLTQISYLQKIP-----------TLPRHFSPSG--------- 376
            :|:...||| :|:....::  |..|...|:::|:|           .|.||.|...         
  Rat    15 DPKSTQGAALRQQGFHDVNKRRAFLQDNSWIKKLPEEEKDENYGRVVLSRHNSHDALDRKITERD 79

  Fly   377 QGLATPPALGSGGM--------GLPSSSS--ASALYAAQAAAGILP-TSPLPLQRHQQYLPPHHQ 430
            :..||.....|..|        ..|.|:.  |.:.::|...|...| |:|:..:| |.:.||   
  Rat    80 EPKATISRYRSEDMLDRSLSTFRTPESTKTPAGSSFSANTTAPSTPATTPVKKKR-QSWFPP--- 140

  Fly   431 QHPGAGMGPGPGSGAA-AGPPLGPQYSP-GCS--ANPKYSNAQLPPPPHHHHQLSPALSTPSPPS 491
              |..|....|.:||: ..|||.|...| .||  |:||    ||   ...|.|:..|        
  Rat   141 --PPPGHNAPPSTGASRRDPPLHPPLPPKPCSPIASPK----QL---RQSHRQMHMA-------- 188

  Fly   492 LLHHPAGGTSSASAHAPFLGGPHMDMQRQSHSDDDSGCALEEYTWVPPGLRPDQVRLYFSQIPDD 556
                .||....|..||          .|...::|                ..|.:|:..:....|
  Rat   189 ----TAGACGEADRHA----------ARNIRTED----------------LDDIIRVAAALQKTD 223

  Fly   557 KVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLT------------------DEERKELR---L 600
            |       ||:.            ||.:|...||.                  |:..:.|.   .
  Rat   224 K-------GEEL------------DNLIRMNKSLNRNQGLDGLFRANLKAQQLDKRAQSLESLIY 269

  Fly   601 FSTQRKRDALGRGN 614
            .:||..||  |:||
  Rat   270 MNTQMDRD--GKGN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 21/113 (19%)
LIM1_Prickle 624..682 CDD:188799
LIM2_Prickle 687..742 CDD:188802
LIM3_Prickle 747..805 CDD:188804
ScelXP_006252490.1 LIM 604..662 CDD:214528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.