DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Fhl4

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001013190.2 Gene:Fhl4 / 314678 RGDID:1308978 Length:280 Species:Rattus norvegicus


Alignment Length:197 Identity:55/197 - (27%)
Similarity:85/197 - (43%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 CDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPR 688
            |.||...|..|:.:|..    ....||..||.||.|:|::....:|.:|...|            
  Rat   100 CKGCLKDIKQGEQSVEY----KGTIWHKDCFVCSNCKEVIGTKTFFPKDEGFY------------ 148

  Fly   689 CSACDEIILADECTEA-----------EGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFD 742
            |.||.:|:....|.:.           :.:.||...|.|..|.|:|..||:.:.:.|.:|:.|:.
  Rat   149 CVACYDILFTKYCVKCNKPITSGGVSYQDQPWHSECFVCVNCSKELSEQRFTVMDDKIFCVDCYK 213

  Fly   743 AMFAEYCDYCGEAI-GVDQGQ--MSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIAC 804
            ...|:.|..|...| |..:|.  ::|:...||  |.||:|..|..:|..:.|:..:..|||. .|
  Rat   214 NFIAKKCAGCKNPITGFGKGSNVVTHETNSWH--DYCFNCKACSVNLANKHFVFHQEQIYCP-DC 275

  Fly   805 SK 806
            :|
  Rat   276 AK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 17/57 (30%)
LIM2_Prickle 687..742 CDD:188802 17/65 (26%)
LIM3_Prickle 747..805 CDD:188804 18/60 (30%)
Fhl4NP_001013190.2 LIM 39..91 CDD:413332
LIM 100..157 CDD:413332 21/72 (29%)
LIM 161..213 CDD:413332 13/51 (25%)
LIM 216..279 CDD:413332 21/65 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.