Sequence 1: | NP_724538.1 | Gene: | pk / 45343 | FlyBaseID: | FBgn0003090 | Length: | 1299 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013190.2 | Gene: | Fhl4 / 314678 | RGDID: | 1308978 | Length: | 280 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 55/197 - (27%) |
---|---|---|---|
Similarity: | 85/197 - (43%) | Gaps: | 33/197 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 624 CDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPR 688
Fly 689 CSACDEIILADECTEA-----------EGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFD 742
Fly 743 AMFAEYCDYCGEAI-GVDQGQ--MSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIAC 804
Fly 805 SK 806 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pk | NP_724538.1 | PET_Prickle | 523..618 | CDD:193602 | |
LIM1_Prickle | 624..682 | CDD:188799 | 17/57 (30%) | ||
LIM2_Prickle | 687..742 | CDD:188802 | 17/65 (26%) | ||
LIM3_Prickle | 747..805 | CDD:188804 | 18/60 (30%) | ||
Fhl4 | NP_001013190.2 | LIM | 39..91 | CDD:413332 | |
LIM | 100..157 | CDD:413332 | 21/72 (29%) | ||
LIM | 161..213 | CDD:413332 | 13/51 (25%) | ||
LIM | 216..279 | CDD:413332 | 21/65 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |