DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Fhl3

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001101449.1 Gene:Fhl3 / 313582 RGDID:1307180 Length:288 Species:Rattus norvegicus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:105/271 - (38%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   576 QLPPHDN-----EVRYCH-----------SLTDE----ERKEL-------RLFSTQRKRDALGRG 613
            ||..||:     |.|:.|           ||.||    :..||       ..||:|         
  Rat    45 QLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQ--------- 100

  Fly   614 NVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCG 678
                      |..|.:.:..|...:   ..| ..:||..||.||.|.:.|....:....|..||.
  Rat   101 ----------CSACGETVMPGSRKL---EYG-GQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCV 151

  Fly   679 RHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDA 743
            ..:.....|||:.|.:.:.....|..: :.||.....|..|...|.||::..|:..|||:.||..
  Rat   152 PCYENKFAPRCARCSKTLTQGGVTYRD-QPWHRECLVCTGCQTPLAGQQFTSRDDDPYCVACFGE 215

  Fly   744 MFAEYCDYC---------GEAIGVDQGQ-MSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAI 798
            :||..|..|         .|..|:..|: :|.:.:|||  ..||||..|..||:|:.|:|....:
  Rat   216 LFAPKCSSCKRPITGGSGSEGAGLGGGKYVSFEDRHWH--HSCFSCARCSTSLVGQGFVPDGDQV 278

  Fly   799 YCSIACSKGEP 809
            .|. .||:..|
  Rat   279 LCQ-GCSQAGP 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/68 (24%)
LIM1_Prickle 624..682 CDD:188799 15/57 (26%)
LIM2_Prickle 687..742 CDD:188802 17/54 (31%)
LIM3_Prickle 747..805 CDD:188804 20/67 (30%)
Fhl3NP_001101449.1 LIM <5..33 CDD:413332
LIM1_FHL3 36..94 CDD:188807 13/48 (27%)
LIM2_FHL3 98..155 CDD:188811 17/79 (22%)
LIM3_FHL 162..213 CDD:188732 14/51 (27%)
LIM 221..284 CDD:413332 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.