| Sequence 1: | NP_724538.1 | Gene: | pk / 45343 | FlyBaseID: | FBgn0003090 | Length: | 1299 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_659048.1 | Gene: | Lmcd1 / 30937 | MGIID: | 1353635 | Length: | 365 | Species: | Mus musculus |
| Alignment Length: | 242 | Identity: | 84/242 - (34%) |
|---|---|---|---|
| Similarity: | 113/242 - (46%) | Gaps: | 35/242 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
Fly 599 RLFSTQRKRDALGRGNV-----------RQLMSARP------------------------CDGCD 628
Fly 629 DLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACD 693
Fly 694 EIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pk | NP_724538.1 | PET_Prickle | 523..618 | CDD:193602 | 31/94 (33%) |
| LIM1_Prickle | 624..682 | CDD:188799 | 27/57 (47%) | ||
| LIM2_Prickle | 687..742 | CDD:188802 | 24/54 (44%) | ||
| LIM3_Prickle | 747..805 | CDD:188804 | |||
| Lmcd1 | NP_659048.1 | PET_testin | 116..203 | CDD:193604 | 31/84 (37%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..231 | 1/30 (3%) | |||
| LIM1_Testin_like | 243..300 | CDD:188726 | 26/56 (46%) | ||
| LIM | 306..359 | CDD:295319 | 23/52 (44%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1704 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D422310at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X39 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.820 | |||||