DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and LMCD1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_055398.1 Gene:LMCD1 / 29995 HGNCID:6633 Length:365 Species:Homo sapiens


Alignment Length:242 Identity:88/242 - (36%)
Similarity:115/242 - (47%) Gaps:35/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
            |.|.|||:.......|...||.:|.|...:.|..||.|||:||||.:|.:...|..|.:.|.|.:
Human   118 YEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLM 182

  Fly   599 RLFSTQRKRDALGRGNV-----------RQLMSARP------------------------CDGCD 628
            ..|..|.|.:|||.|.|           ......:|                        |:.|.
Human   183 EEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDP
SKEVEYVCELCK 247

  Fly   629 DLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACD 693
            .........|::.|.|.|..|||.||.|:.|.|.|||||||.:||..:||||:.|:|:||||.||
Human   248 GAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
CESLRPRCSGCD 312

  Fly   694 EIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            |||.|::....|..|||..||.|..|::.|.|:.||:.:|:..|..|
Human   313 EIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTC 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 33/94 (35%)
LIM1_Prickle 624..682 CDD:188799 27/57 (47%)
LIM2_Prickle 687..742 CDD:188802 25/54 (46%)
LIM3_Prickle 747..805 CDD:188804
LMCD1NP_055398.1 PET_testin 116..203 CDD:193604 33/84 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 1/34 (3%)
LIM1_Testin_like 243..300 CDD:188726 26/56 (46%)
LIM 306..359 CDD:295319 24/52 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.