DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and RGD1566184

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_038956325.1 Gene:RGD1566184 / 298331 RGDID:1566184 Length:411 Species:Rattus norvegicus


Alignment Length:304 Identity:114/304 - (37%)
Similarity:162/304 - (53%) Gaps:33/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
            |.|||........|.|...:|.:|.|...|.|.|||.:||..|||.||.:...||.|:.:|.||:
  Rat   103 YEWVPSVQNKALTRQYMQMLPKEKQPVSGSEGAQYRKKQLAKQLPAHDQDPNKCHELSRKEAKEM 167

  Fly   599 RLFSTQRKRDALGRGNVR------------------------------QLMSARP---CDGCDDL 630
            |.|..:.|.:|||.|:||                              .:...:|   |..|...
  Rat   168 RQFVKKYKNEALGVGDVRLPS
EMNVQHYKGHNPATDRNTPTAVDFKDTSMEPKKPQYSCYSCKHA 232

  Fly   631 ISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEI 695
            :..|:.|:||.|.|.:..||||||.|::|.|:|||:|||.::|::|||||:.::.||||:.|||:
  Rat   233 VKEGNPAIFAERAGYDKLWHPACFICTICGEILVDMIYFWKNGKLYCGRHY
CDSEKPRCAGCDEL 297

  Fly   696 ILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQ 760
            |.::|.|:||.:.||:.||.|..|...|.|:.|:|...||.|..|:..:.|..|..|..||..::
  Rat   298 IFSNEYTQAENKNWHLIHFCCFHCHNVLAGKIYVMVGSKPVCKSCYM
KIHAVVCQGCHNAIDPEE 362

  Fly   761 GQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIAC 804
            .::.:....|||:..||.|:.|...|||:.|:...|.|:|||.|
  Rat   363 QRVIYQNFSWHASTACFLCSCCSKCLLGKKFIRVEGMIFCSIEC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 36/113 (32%)
LIM1_Prickle 624..682 CDD:188799 29/57 (51%)
LIM2_Prickle 687..742 CDD:188802 25/54 (46%)
LIM3_Prickle 747..805 CDD:188804 21/58 (36%)
RGD1566184XP_038956325.1 PET_testin 101..188 CDD:193604 36/84 (43%)
LIM1_Testin 226..283 CDD:188797 28/56 (50%)
LIM 289..344 CDD:413332 25/54 (46%)
LIM3_Testin 351..409 CDD:188803 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.