DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Lpxn

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_038964643.1 Gene:Lpxn / 293783 RGDID:1304981 Length:398 Species:Rattus norvegicus


Alignment Length:295 Identity:83/295 - (28%)
Similarity:120/295 - (40%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 FSQIPDDK---VPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSL-TDEERKEL------------ 598
            :|::.:.|   :|...|...|      |.:|..|.||::...|: .|..||.|            
  Rat    84 YSEVQEPKQSVLPPKTSAAAQ------LDELMAHLNELQAKVSVKADASRKPLPDKQDHKASLDS 142

  Fly   599 RLFSTQRKRDALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELL 663
            .|...:::...||...|.:    ..|..|...|: |.: :.|  ||  .||||..|.|:.|:|.|
  Rat   143 MLGGLEQELQDLGIATVPK----GHCASCQKPIA-GKV-IHA--LG--QSWHPEHFVCTHCKEEL 197

  Fly   664 VDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRY 728
            ....:|.|:|..||.:.:.....|||:.|...| .|:...|..:.||..||.|..|.:..|.:.:
  Rat   198 GSSPFFERNGLAYCSKDYHHLFSPRCAYCAAPI-TDKVLTAMNKTWHPEHFFCSHCGEVFGAEGF 261

  Fly   729 IMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLP 793
            ..::.||||...|.|||:..|..|...  |.:..:|.....||  .|||.|..|..|....:|..
  Rat   262 HEKDKKPYCRKDFLAMFSPKCGGCNRP--VLENYLSAMNTVWH--PECFVCGDCFSSFSSGSFFE 322

  Fly   794 RRGAIYCSI--------ACSK-GEPPTPSDSSGTG 819
            ..|..:|.:        .|.. |:|.|....|..|
  Rat   323 LDGRPFCELHYHHRRGTLCHDCGQPITGRCISAMG 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 19/83 (23%)
LIM1_Prickle 624..682 CDD:188799 21/57 (37%)
LIM2_Prickle 687..742 CDD:188802 18/54 (33%)
LIM3_Prickle 747..805 CDD:188804 15/65 (23%)
LpxnXP_038964643.1 LIM1_Leupaxin 162..216 CDD:188790 21/59 (36%)
LIM 223..274 CDD:413332 16/51 (31%)
LIM 282..334 CDD:413332 15/55 (27%)
LIM4_Paxillin_like 341..392 CDD:188725 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.