DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and FHL2

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:258 Identity:65/258 - (25%)
Similarity:96/258 - (37%) Gaps:81/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   617 QLMSARPCD------GCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRM 675
            :.:.|..|:      |||    ..|::.      .:..||.|||.||.||..|||..:..::.::
Human    33 E
TLFANTCEECGKPIGCD----CKDLSY------KDRHWHEACFHCSQCRNSLVDKPFAAKEDQL 87

  Fly   676 YCGRHHAETLKPRCSACDEIIL-ADECTEAEGRAWHMNHFACHECD------------------- 720
            .|...::.....:|..|.:.|: .....|.:|.:||...|.||.|.                   
Human    88 LCTDCYSNEY
SSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVP 152

  Fly   721 ----------------------------------------KQLGGQRYIMREGKPYCLHCFDAMF 745
                                                    |||.|||:..|:...|||:||..::
Human   153 CYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLY 217

  Fly   746 AEYCDYCGEAIGVDQG--QMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSK 806
            |:.|..|...|....|  .:|.:.:.||  ::||:|..|..||:||.||..|..|.|. .|.|
Human   218 AKKCAGCTNPISGLGGTKYISFEERQWH--NDCFNCKKCSLSLVGRGFLTERDDILCP-DCGK 277

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity