DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Lims2

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001366066.1 Gene:Lims2 / 225341 MGIID:2385067 Length:341 Species:Mus musculus


Alignment Length:263 Identity:70/263 - (26%)
Similarity:102/263 - (38%) Gaps:57/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 PDDKVPYVNSPGEQYR-----VRQLLHQLPP---HDNEVR-YC-HSLTDEERKELRLFSTQRKRD 608
            |.:::  |||.||.|.     ..|.....|.   ::.|.| || |..                  
Mouse    24 PTERI--VNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCEHDF------------------ 68

  Fly   609 ALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDG 673
                    |::.|..|..|      |:..:.......||:|||.||.|.:|...|.||.:....|
Mouse    69 --------QMLFA
PCCGFC------GEFVIGRVIKAMNANWHPGCFRCELCDVELADLGFVKNAG 119

  Fly   674 RMYC----GRHHAETL-KPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREG 733
            |..|    .|..|:.| |..|..| .:.:.::....:...:|.:||:|..|.|:|......:: |
Mouse   120 RHLCRPCH
NREKAKGLGKFICQRC-HLAIDEQPLMFKNDPYHPDHFSCSNCGKELTSDARELK-G 182

  Fly   734 KPYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHD-GQHWHATDECFSCNTCRCSLLGRAFLPRRGA 797
            :.|||.|.|.|....|..|...|   :|::.:. |:.||.  |.|.|..|....||.....::|.
Mouse   183 ELYCLPCH
DKMGIPICGACRRPI---EGRVVNALGKQWHV--EHFVCAKCEKPFLGHRHYEKKGL 242

  Fly   798 IYC 800
            .||
Mouse   243 AYC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 14/73 (19%)
LIM1_Prickle 624..682 CDD:188799 19/61 (31%)
LIM2_Prickle 687..742 CDD:188802 14/54 (26%)
LIM3_Prickle 747..805 CDD:188804 16/55 (29%)
Lims2NP_001366066.1 LIM1_PINCH 15..73 CDD:188717 15/76 (20%)
LIM2_PINCH 76..127 CDD:188718 18/56 (32%)
LIM3_PINCH 140..190 CDD:188719 13/51 (25%)
LIM4_PINCH 196..249 CDD:188720 16/55 (29%)
LIM5_PINCH 257..310 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.