DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Y1A5A.1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_497801.1 Gene:Y1A5A.1 / 175515 WormBaseID:WBGene00012379 Length:192 Species:Caenorhabditis elegans


Alignment Length:184 Identity:49/184 - (26%)
Similarity:73/184 - (39%) Gaps:24/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 VNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL----RLFSTQRKRDALGRGNVRQLMSA 621
            :.|....|.:..|...:|.:..::..|...   |.|.:    ..|:.:|...::.|         
 Worm    12 IMSVNPSYPLPLLCQYIPRYHPQMPTCPLF---ESKSIITPVFYFNCKRMDRSIDR--------- 64

  Fly   622 RPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLK 686
            |.|..|..  |.|..|:.|.    |..|||..|.||.|:. .:...:...|...||.:..|:...
 Worm    65 RLCGHCHQ--SIGSEALVAM----NRLWHPDHFTCSSCKR-PIKQTFQAADNHAYCVQCFAQKYN 122

  Fly   687 PRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            |:|:.|.| .|.|.|..|..|.||...|.|..|::.|....:.:.:.|||.|.|
 Worm   123 PKCAGCME-TLVDTCLLALDRHWHPRCFTCSSCNRPLPNGEFYLVDDKPYDLDC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 10/60 (17%)
LIM1_Prickle 624..682 CDD:188799 17/57 (30%)
LIM2_Prickle 687..742 CDD:188802 20/54 (37%)
LIM3_Prickle 747..805 CDD:188804
Y1A5A.1NP_497801.1 LIM 67..117 CDD:295319 17/56 (30%)
LIM_DA1 125..176 CDD:188782 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.