DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Fhl4

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_034344.2 Gene:Fhl4 / 14202 MGIID:1338765 Length:279 Species:Mus musculus


Alignment Length:159 Identity:50/159 - (31%)
Similarity:75/159 - (47%) Gaps:6/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 WHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSAC-DEIILADECTEAEGRAWHMN 712
            ||..||.||.|.:||....:...|..:.|.:.......|:|..| .:|...|...|.:|..||.|
Mouse    60 WHNTCFKCSKCSQLLATETFVAWDKNILCNKCA
TRVTFPKCKGCLKDIEEGDHNVEYKGSIWHKN 124

  Fly   713 HFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECF 777
            .|.|..|...:|.:.:..::...||:.|:||:|.::|..|.:.|  ..|.:|:..|.||:  |||
Mouse   125 CFVCTNCKDIIGTKNFFPKDEGFYCVTCYDALF
TKHCMKCKKPI--TSGGVSYQDQPWHS--ECF 185

  Fly   778 SCNTCRCSLLGRAFLPRRGAIYCSIACSK 806
            .|.:|...|.|:.|.......:| :.|.|
Mouse   186 VCVSCSKELSGQRFTAMDDQYFC-VDCYK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 11/32 (34%)
LIM2_Prickle 687..742 CDD:188802 17/55 (31%)
LIM3_Prickle 747..805 CDD:188804 17/57 (30%)
Fhl4NP_034344.2 LIM <4..32 CDD:295319
LIM 39..92 CDD:295319 11/31 (35%)
LIM2_FHL1 100..157 CDD:188808 18/56 (32%)
LIM3_FHL1 161..213 CDD:188813 18/56 (32%)
LIM4_FHL1 216..279 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.