DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Fhl2

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001276462.1 Gene:Fhl2 / 14200 MGIID:1338762 Length:279 Species:Mus musculus


Alignment Length:187 Identity:60/187 - (32%)
Similarity:86/187 - (45%) Gaps:14/187 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 CDGCDDLISTGDIAVFATRL--GPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLK 686
            |..|...|..|      ||.  ...:|||..||.|..|::.:....:..::.:.:|...:.:...
Mouse   101 CQECKKTIMPG------TRKMEYKGSSWHETCFTCQRCQQPIGTKSFIPKENQNFCVPCYEKQYA 159

  Fly   687 PRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDY 751
            .:|..|.:.|.....|..| :.||...|.|..|.|||.|||:..|:..||||.||..::|:.|..
Mouse   160 LQCVQCKKPITTGGVTYRE-QPWHKECFVCTACKKQLSGQRFTARDEFPYCLTCFCDLYAKKCAG 223

  Fly   752 CGEAIGVDQG--QMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYCSIACSK 806
            |...|....|  .:|.:.:.||  ::||:|..|..||:||.||..|..|.|. .|.|
Mouse   224 CTNPISGLGGTKYISFEERQWH--NDCFNCKKCSLSLVGRGFLTERDDILCP-DCGK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 14/59 (24%)
LIM2_Prickle 687..742 CDD:188802 22/54 (41%)
LIM3_Prickle 747..805 CDD:188804 20/59 (34%)
Fhl2NP_001276462.1 LIM <5..33 CDD:413332
LIM 36..97 CDD:413332
LIM 101..157 CDD:413332 14/61 (23%)
LIM 162..218 CDD:413332 23/56 (41%)
LIM4_FHL2 221..278 CDD:188817 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.