DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and Lims1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_006513131.1 Gene:Lims1 / 110829 MGIID:1195263 Length:398 Species:Mus musculus


Alignment Length:306 Identity:74/306 - (24%)
Similarity:106/306 - (34%) Gaps:112/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 PDDKVPYVNSPGEQYRVR-----QLLHQLPP---HDNEVR-YC-HSLTDEERKELRLFSTQRKRD 608
            |.:|:  |||.||.|..:     |...|.|.   ::.|.| || |..                  
Mouse    81 PAEKI--VNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDF------------------ 125

  Fly   609 ALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVD-------- 665
                    |::.|..|..|      |:..:.......|.||||.||.|.:|:|:|.|        
Mouse   126 --------QMLFA
PCCHQC------GEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAG 176

  Fly   666 --------------------------------LIY----FHRD-------------------GRM 675
                                            ||:    :|.|                   |.:
Mouse   177 RHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGEL 241

  Fly   676 YCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            ||...|.:...|.|.||...| ......|.|:.||:.||.|.:|:|...|.|:..|:|..||...
Mouse   242 YCLPCH
DKMGVPICGACRRPI-EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETH 305

  Fly   741 FDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSL 786
            ::.:|.:.|.:|...|..|  .:|...:.|..:  ||:|:||...|
Mouse   306 Y
NQLFGDVCFHCNRVIEGD--VVSALNKAWCVS--CFACSTCNTKL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/73 (22%)
LIM1_Prickle 624..682 CDD:188799 22/120 (18%)
LIM2_Prickle 687..742 CDD:188802 20/54 (37%)
LIM3_Prickle 747..805 CDD:188804 12/40 (30%)
Lims1XP_006513131.1 LIM1_PINCH 72..130 CDD:188717 17/76 (22%)
LIM2_PINCH 133..184 CDD:188718 15/56 (27%)
LIM3_PINCH 197..247 CDD:188719 7/49 (14%)
LIM4_PINCH 253..306 CDD:188720 20/53 (38%)
LIM5_PINCH 314..367 CDD:188721 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.