DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and LIMS4

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001358269.1 Gene:LIMS4 / 100288695 HGNCID:39941 Length:398 Species:Homo sapiens


Alignment Length:299 Identity:72/299 - (24%)
Similarity:101/299 - (33%) Gaps:110/299 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 VNSPGEQYRVR-----QLLHQLPP---HDNEVR-YC-HSLTDEERKELRLFSTQRKRDALGRGNV 615
            |||.||.|..:     |...|.|.   ::.|.| || |..                         
Human    86 VNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDF------------------------- 125

  Fly   616 RQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVD--------------- 665
             |::.|..|..|      |:..:.......|.||||.||.|.:|:|:|.|               
Human   126 -QMLFA
PCCHQC------GEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPC 183

  Fly   666 -------------------------LIY----FHRD-------------------GRMYCGRHHA 682
                                     ||:    :|.|                   |.:||...|.
Human   184 HNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKDLTADAQELKGELYCLPCHD 248

  Fly   683 ETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAE 747
            :...|.|.||...| ......|.|:.||:.||.|.:|:|...|.|:..|:|..||...::.:|.:
Human   249 KMGVPICGACRRPI-EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGD 312

  Fly   748 YCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSL 786
            .|.:|...|..|  .:|...:.|..  .||:|:||...|
Human   313 VCFHCNRVIEGD--VVSALNKAWCV--NCFACSTCNTKL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 14/66 (21%)
LIM1_Prickle 624..682 CDD:188799 22/120 (18%)
LIM2_Prickle 687..742 CDD:188802 20/54 (37%)
LIM3_Prickle 747..805 CDD:188804 12/40 (30%)
LIMS4NP_001358269.1 LIM1_PINCH 72..130 CDD:188717 15/69 (22%)
LIM2_PINCH 133..184 CDD:188718 15/56 (27%)
LIM3_PINCH 197..247 CDD:188719 7/49 (14%)
LIM4_PINCH 253..306 CDD:188720 20/53 (38%)
LIM5_PINCH 314..367 CDD:188721 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1704
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.