DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and lims1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_012812021.1 Gene:lims1 / 100216119 XenbaseID:XB-GENE-967923 Length:397 Species:Xenopus tropicalis


Alignment Length:306 Identity:73/306 - (23%)
Similarity:105/306 - (34%) Gaps:112/306 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 PDDKVPYVNSPGEQYRVR-----QLLHQLPP---HDNEVR-YC-HSLTDEERKELRLFSTQRKRD 608
            |.:|:  |||.||.|..:     |...|.|.   ::.|.| || |..                  
 Frog    82 PSEKI--VNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDF------------------ 126

  Fly   609 ALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVD-------- 665
                    |::.|..|..|      |:..:.......|.||||.||.|.:|:::|.|        
 Frog   127 --------QMLFA
PCCHQC------GEFIIGRVIKAMNNSWHPECFRCDICQQVLADIGFVKNAG 177

  Fly   666 --------------------------------LIY----FHRD-------------------GRM 675
                                            ||:    :|.|                   |.:
 Frog   178 RHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGEL 242

  Fly   676 YCGRHHAETLKPRCSACDEIILADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHC 740
            ||...|.:...|.|.||...| ......|.|:.||:.||.|.:|:|...|.|:..|:|..||...
 Frog   243 YCLPCH
DKMGVPICGACRRPI-EGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETH 306

  Fly   741 FDAMFAEYCDYCGEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSL 786
            ::.:|.:.|.:|...|..|  .:|...:.|..  .||:|:||...|
 Frog   307 Y
NQLFGDVCFHCNRVIEGD--VVSALNKAWCV--NCFACSTCNTKL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 16/73 (22%)
LIM1_Prickle 624..682 CDD:188799 21/120 (18%)
LIM2_Prickle 687..742 CDD:188802 20/54 (37%)
LIM3_Prickle 747..805 CDD:188804 12/40 (30%)
lims1XP_012812021.1 LIM1_PINCH 73..131 CDD:188717 17/76 (22%)
LIM2_PINCH 134..185 CDD:188718 14/56 (25%)
LIM3_PINCH 198..248 CDD:188719 7/49 (14%)
LIM4_PINCH 254..307 CDD:188720 20/53 (38%)
LIM5_PINCH 315..368 CDD:188721 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.