DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl2

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001120233.1 Gene:fhl2 / 100145283 XenbaseID:XB-GENE-969632 Length:279 Species:Xenopus tropicalis


Alignment Length:178 Identity:53/178 - (29%)
Similarity:85/178 - (47%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   624 CDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPR 688
            |||.|  :|..|           ..||.:||.|..|::.|||..:..:|..:.|...::.....:
 Frog    49 CDGKD--LSYKD-----------RHWHESCFHCFQCKKSLVDKPFAAKDEHLICTECYSNEYSSK 100

  Fly   689 CSACDEIIL-ADECTEAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYC 752
            ||.|.:.|: .....|.:|.:||...|.|..|.:.:|.:.:|.::.:.:|:.|::..||.:|..|
 Frog   101 CSECKKTIMPGTRKMEYKGNSWHETCFICSRCQQPIGTKSFIPKDNQNFCVACYEKQFAMHCVQC 165

  Fly   753 GEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAFLPRRGAIYC 800
            .:||  ..|.:::..|.||  .|||.|..|:..|.|:.|..|....||
 Frog   166 KKAI--TTGGVTYRDQPWH--KECFICTGCKKPLSGQRFTSRDEFAYC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 17/57 (30%)
LIM2_Prickle 687..742 CDD:188802 15/55 (27%)
LIM3_Prickle 747..805 CDD:188804 19/54 (35%)
fhl2NP_001120233.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806 17/60 (28%)
LIM2_FHL2 101..157 CDD:188810 15/55 (27%)
LIM3_Fhl2 162..218 CDD:188815 19/52 (37%)
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.