DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and fhl5

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:NP_001116957.1 Gene:fhl5 / 100144736 XenbaseID:XB-GENE-1002465 Length:282 Species:Xenopus tropicalis


Alignment Length:224 Identity:62/224 - (27%)
Similarity:101/224 - (45%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 HSLTDE---ERKELRL----FSTQRKRDALGRGNVRQLMSARPCDGCDDLISTGDIAVFATRLGP 645
            |||.::   .:.||.|    :||:               .:..|.||...|..|     :.::..
 Frog    74 HSLVEKPFAAKDELLLCIECYS
TE---------------YSSKCFGCRATIMPG-----SRKMEY 118

  Fly   646 NAS-WHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECTEAEGRAW 709
            |.| ||..||.|..|||.:.:..:..::.::||...:.:....:|.:|.:.|.....:..| :.|
 Frog   119 NGSNWHETCFVCQSCREPVGNKPFIPKESKIYCMPCY
EKQFANQCKSCRKAITKGGLSFQE-QQW 182

  Fly   710 HMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIGVDQG---QMSHDGQHWH 771
            |...|.|..|.|.|.|::...|:..|||:.|||.::|:.|..|.:.| ..||   .:|.:.:.||
 Frog   183 HRECFVCTSCKKNLVGEKSTSRDESPYCVDCF
DNLYAKKCAACAKPI-TGQGGAKYISFEDRQWH 246

  Fly   772 ATDECFSCNTCRCSLLGRAFLPRRGAIYC 800
            :  :||:|..|..||:|..|......:.|
 Frog   247 S--DCFTCAKCSKSLVGEKFHTNEDDVLC 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 8/36 (22%)
LIM1_Prickle 624..682 CDD:188799 17/58 (29%)
LIM2_Prickle 687..742 CDD:188802 17/54 (31%)
LIM3_Prickle 747..805 CDD:188804 17/57 (30%)
fhl5NP_001116957.1 LIM <6..33 CDD:351770
LIM1_FHL 37..95 CDD:188729 6/20 (30%)
LIM2_FHL 102..155 CDD:188731 17/57 (30%)
LIM3_FHL 163..214 CDD:188732 16/51 (31%)
LIM4_FHL 222..277 CDD:188733 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.