DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pk and lmcd1

DIOPT Version :9

Sequence 1:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster
Sequence 2:XP_012815919.1 Gene:lmcd1 / 100124907 XenbaseID:XB-GENE-966902 Length:352 Species:Xenopus tropicalis


Alignment Length:250 Identity:84/250 - (33%)
Similarity:123/250 - (49%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 YTWVPPGLRPDQVRLYFSQIPDDKVPYVNSPGEQYRVRQLLHQLPPHDNEVRYCHSLTDEERKEL 598
            |.|.||||.......|...||.:..|...:.|..||..|||.||||:|:....|..|::.||..:
 Frog   113 YEWAPPGLNQKLAMQYMELIPKNMQPVAGTEGAHYRRVQLLRQLPPYDHNPDLCQGLSERERTAM 177

  Fly   599 RLFSTQRKRDALGRGNVRQLMSARP--------------------------CDGCDDLISTGDIA 637
            ..|..:.|..|||...|....||:.                          |:.|...:|....|
 Frog   178 EDFVKRYKEQALGVAEVALPC
SAKQQTEKNGSKSKETNGTAKEAFEKTEYFCEMCQQPLSRDAPA 242

  Fly   638 VFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPRCSACDEIILADECT 702
            |:|.|.|.:..||||||.|..|||.||:||||.|:..::||||:.|:.:|||:.||::|.:::..
 Frog   243 VYAERAGFDKQWHPACFMCCQCREPLVNLIYFWRNNSLWCGRHY
CESERPRCAGCDQMIFSEDYE 307

  Fly   703 EAEGRAWHMNHFACHECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYCGEAIG 757
            :.:...||.:||:|.:||:.|.|:.|::.:.:|            .||.|.::.|
 Frog   308 QVDSGFWHRHHFSCTDCDQTLSGKPYVLDKAQP------------LCDLC
SQSRG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pkNP_724538.1 PET_Prickle 523..618 CDD:193602 31/83 (37%)
LIM1_Prickle 624..682 CDD:188799 29/57 (51%)
LIM2_Prickle 687..742 CDD:188802 17/54 (31%)
LIM3_Prickle 747..805 CDD:188804 3/10 (30%)
lmcd1XP_012815919.1 PET_testin 111..198 CDD:193604 31/84 (37%)
LIM1_Testin_like 229..286 CDD:188726 28/56 (50%)
LIM 292..345 CDD:351770 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422310at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.