DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and ATOH8

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011531441.1 Gene:ATOH8 / 84913 HGNCID:24126 Length:328 Species:Homo sapiens


Alignment Length:312 Identity:95/312 - (30%)
Similarity:141/312 - (45%) Gaps:81/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SPDIRPK-GTDSADSK---PIALVRNKRKSSEPFKVV--GLTTPNSKSMPGPPSSASMNATGPLK 116
            :|.:.|: |||:|..:   ....|.:.||.......|  ||.||   ..|.||:..|....||..
Human    81 APAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPGLPTP---PPPPPPAPQSQAPGGPEA 142

  Fly   117 KRIRYTSSADSAVVLTPPAIDSP--PPNSCIP--STLRLQHEIMPNPAHIYVRHPGVTTLHRSLA 177
            :..|........::..|||..:|  ||....|  ||:|      |.|.    ..||.::      
Human   143 QPFREPGLRPRILLCAPPARPAPSAPPAPPAPPESTVR------PAPP----TRPGESS------ 191

  Fly   178 AHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDE 242
                                     ..:.|.::......:..:.::|..:.:.:||.::|     
Human   192 -------------------------YSSISHVIYNNHQDSSASPRKRPGEATAASSEIKA----- 226

  Fly   243 DLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKL 307
                                  :.:.||:.|||||||||||||||:|.||:.||.|:..||||||
Human   227 ----------------------LQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKL 269

  Fly   308 SVLRVACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTIQTEGKVKRKKD 359
            ::||:||:|||:|:|:|..|||||.|..|.:.|::..|.|:|.||:.|::||
Human   270 AILRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 36/50 (72%)
ATOH8XP_011531441.1 HLH 231..282 CDD:278439 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147320
Domainoid 1 1.000 78 1.000 Domainoid score I8806
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007208
OrthoInspector 1 1.000 - - oto88324
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5566
SonicParanoid 1 1.000 - - X5318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.