DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and mespa

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001039184.1 Gene:mespa / 734031 XenbaseID:XB-GENE-920825 Length:310 Species:Xenopus tropicalis


Alignment Length:211 Identity:52/211 - (24%)
Similarity:80/211 - (37%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 TTLHRSLAAHPEQLEPL---ALVTTKKQC-------VDQAG-----PKIEAFSALLIGKQPSA-- 217
            |.||.:.:..|:|..||   ....::..|       :|.:|     |.. ||:....|...:|  
 Frog     6 TKLHLNQSLSPQQCNPLQQWGYPDSEGYCSLSPASSIDSSGFSPPYPSC-AFANEAYGSIHTAFT 69

  Fly   218 -KKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRV 281
             .:.||.:.|..||.                         :.|||.|...|.|. .|:.||:.|:
 Frog    70 QMEKLKSKPQDTSTK-------------------------KDQRNRKVYDRVRN-SASEREKMRM 108

  Fly   282 HTISAAYETLRQAV-PAYASTQK-LSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIATCLEAV 344
            ..:|:|.:.||:.: ||.|...| |:|:..||:...||..||.:.|.|                 
 Frog   109 RNLSSALQNLRRYLPPAVAPIGKTLTKIETLRLTIRYISHLSEVLGLD----------------- 156

  Fly   345 TSTIQTEGKVKRKKDE 360
                 .|..:||:::|
 Frog   157 -----EETLIKRREEE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/52 (37%)
mespaNP_001039184.1 bHLH_SF 97..160 CDD:381792 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.