DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and TAL1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001274276.1 Gene:TAL1 / 6886 HGNCID:11556 Length:331 Species:Homo sapiens


Alignment Length:331 Identity:70/331 - (21%)
Similarity:114/331 - (34%) Gaps:124/331 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KDSPNSNDRDA--------------GFCSASSESEGGDDLVVEHARSGSPDIRP----------K 64
            :..|....|||              |....:|.:...:..|:|....|.|...|          |
Human    11 RSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGAARDLK 75

  Fly    65 GTDSADSKPIALVRNKRKSSEPFKVVGLTTPNSKSMPGP---PSSASMNATGPLKKRIRYTSSAD 126
            |.|:|.::    .|::..::|      |..|     |||   |:.||:.|..|...|:       
Human    76 GRDAATAE----ARHRVPTTE------LCRP-----PGPAPAPAPASVTAELPGDGRM------- 118

  Fly   127 SAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQLEPLALVTT 191
              |.|:|||:.:|               ..|..|.:|.....:.:|.......|   :...:.||
Human   119 --VQLSPPALAAP---------------AAPGRALLYSLSQPLASLGSGFFGEP---DAFPMFTT 163

  Fly   192 KKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPH 256
            ..:                :.::||.                 .|..::|            .||
Human   164 NNR----------------VKRRPSP-----------------YEMEITD------------GPH 183

  Fly   257 QHQRNYKNMTR-ERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTL 320
                     |: .|||..|:|||.|...::.|:..||:.:|.:...:||||..:||:|..||..|
Human   184 ---------TKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFL 239

  Fly   321 SRMAGE 326
            :::..:
Human   240 AKLLND 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
TAL1NP_001274276.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..86 10/49 (20%)
HLH 193..243 CDD:197674 19/49 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.