powered by:
Protein Alignment net and ASCL5
DIOPT Version :9
Sequence 1: | NP_001259789.1 |
Gene: | net / 45339 |
FlyBaseID: | FBgn0002931 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001257530.1 |
Gene: | ASCL5 / 647219 |
HGNCID: | 33169 |
Length: | 206 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 33/72 - (45%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 NARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMA-----GEDYSADQS 333
|.|||.||..::..|..||..:|...:.::|||:..||.|..||..|..:. |....|.:.
Human 89 NERERQRVKCVNEGYARLRGHLPGALAEKRLSKVETLRAAIRYIKYLQELLSSAPDGSTPPASRG 153
Fly 334 VPSIATC 340
:|....|
Human 154 LPGTGPC 160
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
net | NP_001259789.1 |
HLH |
269..320 |
CDD:278439 |
18/45 (40%) |
ASCL5 | NP_001257530.1 |
HLH |
89..141 |
CDD:197674 |
19/51 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.