DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and myf5

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571651.1 Gene:myf5 / 58097 ZFINID:ZDB-GENE-000616-6 Length:237 Species:Danio rerio


Alignment Length:136 Identity:42/136 - (30%)
Similarity:61/136 - (44%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 ESTSSSFLEASLSDEDLNKTGLAPISRPHQ--HQRNY-------KNMTRERRIEANARERTRVHT 283
            |..:|..|..|..||.:...|     .|||  |...:       |..|.:||..|..|||.|:..
Zfish    23 EFGASGELTGSEEDEHVRAPG-----APHQPGHCLQWACKACKRKASTVDRRRAATMRERRRLKK 82

  Fly   284 ISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTI 348
            ::.|:|.||:...|..| |:|.|:.:||.|..||.:|..:..|......|:|..::...|..|:.
Zfish    83 VNHAFEALRRCTSANPS-QRLPKVEILRNAIQYIESLQELLREQVEQYYSLPMESSSEPASPSSS 146

  Fly   349 QTEGKV 354
            .:|..|
Zfish   147 CSESMV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
myf5NP_571651.1 BASIC 4..72 CDD:128794 15/53 (28%)
HLH 68..119 CDD:278439 21/51 (41%)
Myf5 <151..199 CDD:289036 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.