DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and AgaP_AGAP000878

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001688970.1 Gene:AgaP_AGAP000878 / 5666740 VectorBaseID:AGAP000878 Length:387 Species:Anopheles gambiae


Alignment Length:239 Identity:51/239 - (21%)
Similarity:77/239 - (32%) Gaps:117/239 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GPLKKRI---RYTSSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHR 174
            ||||:::   .|. |||:.:   |||:.                               :.||.:
Mosquito    27 GPLKRKLPLGNYV-SADNVL---PPAVT-------------------------------IATLAK 56

  Fly   175 SLAAHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASL 239
            .||.                    |||...      :| .|..|::.:.||...:.         
Mosquito    57 QLAG--------------------AGPPAG------LG-LPGRKRSSEPRTAVSAV--------- 85

  Fly   240 SDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVP-------- 296
                                        |||   |||||.||..::..:..|||.:|        
Mosquito    86 ----------------------------ERR---NARERNRVQQVNNGFAALRQRIPDEIADAFE 119

  Fly   297 ----AYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPS 336
                |....:||||:..||:|..||.:|.|:..:..:|...:|:
Mosquito   120 AGTTARGVHKKLSKVETLRMAVEYIKSLERLLEQSGTAAGRLPA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 23/62 (37%)
AgaP_AGAP000878XP_001688970.1 HLH 96..153 CDD:197674 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.