DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Atoh8

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001102711.1 Gene:Atoh8 / 500200 RGDID:1561512 Length:322 Species:Rattus norvegicus


Alignment Length:315 Identity:98/315 - (31%)
Similarity:146/315 - (46%) Gaps:84/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SGSPDIRP-KGTDSA-DSKPIAL--VRNKRKSSEPFKVV--GLTTPNSKSMPGPPSSASMNATGP 114
            |.:|.:.| .|||:| :.:.|..  |.:.||.......|  ||.||     |.||:|.|:....|
  Rat    81 SVAPAVPPGGGTDTAREFRGIRAPEVSDARKRGFALGTVGPGLPTP-----PPPPASQSLAPGDP 140

  Fly   115 LKKRIRYTSSADSAVVLTPPAIDSPPPNSCI-PSTLRLQHEIMPNPAHIYVRHPGVTTL----HR 174
            ..:.:|..:.....::..|||  .|.|::.: |..:..:..:.|.|.    ..||.::.    |.
  Rat   141 EVQPLREQALRPRILLCAPPA--RPTPSAPLAPPAVPQESPVRPAPP----TRPGESSYSSISHV 199

  Fly   175 SLAAHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASL 239
            ....||:               ..|.|:          |:|.           |:|::|      
  Rat   200 IYNNHPD---------------SSASPR----------KRPG-----------EATAAS------ 222

  Fly   240 SDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKL 304
                                ...|.:.:.||:.|||||||||||||||:|.||:.||.|:..|||
  Rat   223 --------------------TEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKL 267

  Fly   305 SKLSVLRVACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTIQTEGKVKRKKD 359
            |||::||:||:|||:|:|:|..|||||.|..|.:.|::..|.|:|.||:.|::|:
  Rat   268 SKLAILRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 36/50 (72%)
Atoh8NP_001102711.1 HLH 232..283 CDD:278439 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340970
Domainoid 1 1.000 78 1.000 Domainoid score I8621
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I4730
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007208
OrthoInspector 1 1.000 - - oto95471
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19290
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.940

Return to query results.
Submit another query.