DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurod6

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001102707.1 Gene:Neurod6 / 500137 RGDID:1562793 Length:337 Species:Rattus norvegicus


Alignment Length:135 Identity:52/135 - (38%)
Similarity:74/135 - (54%) Gaps:12/135 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KQCVDQAG-PKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPH 256
            :||.||.. .|.|:|...::.:..|.|:...|.|:||..     |....:||.|  || |..|..
  Rat    23 RQCEDQKQIKKPESFPKQVVLRGKSIKRAPGEETEKEEE-----EEDREEEDEN--GL-PRRRGL 79

  Fly   257 QHQRNYK---NMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYIL 318
            :.::..|   ...:.||.|||||||.|:|.::.|.:.||:.||.|:.||||||:..||:|.:||.
  Rat    80 RKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETLRLAKNYIW 144

  Fly   319 TLSRM 323
            .||.:
  Rat   145 ALSEI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
Neurod6NP_001102707.1 HLH 100..151 CDD:197674 26/50 (52%)
Neuro_bHLH 153..272 CDD:315246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.