DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and NEUROD2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_006151.3 Gene:NEUROD2 / 4761 HGNCID:7763 Length:382 Species:Homo sapiens


Alignment Length:238 Identity:64/238 - (26%)
Similarity:90/238 - (37%) Gaps:77/238 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DSPPPNSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGP 201
            |:|||               |.||      ||......:.||.|..|.                 
Human    35 DAPPP---------------PPPA------PGPGAPGPARAAKPVPLR----------------- 61

  Fly   202 KIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGL--APISRPHQHQRNYKN 264
                      |::.:      |.|..|......|.....:|:..:.||  |...||.:.....:.
Human    62 ----------GEEGT------EATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRK 110

  Fly   265 MTRE-------RRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSR 322
            ||:.       ||.:||||||.|:|.::||.:.||:.||.|:.||||||:..||:|.:||..||.
Human   111 MTKARLERSKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSE 175

  Fly   323 MAGEDYSAD-----------QSVPS---IATCLEAVTSTIQTE 351
            :.......|           .|.|:   :|.||:..:....||
Human   176 ILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
NEUROD2NP_006151.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 30/147 (20%)
bHLH_TS_NeuroD2 88..180 CDD:381563 37/91 (41%)
Nuclear localization signal. /evidence=ECO:0000255 107..113 1/5 (20%)
Neuro_bHLH 180..310 CDD:403655 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.