DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and NEUROD1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_002491.3 Gene:NEUROD1 / 4760 HGNCID:7762 Length:356 Species:Homo sapiens


Alignment Length:161 Identity:49/161 - (30%)
Similarity:74/161 - (45%) Gaps:40/161 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRE-------R 269
            |::....:.|:|..::|.          .|:|         .:|.:.....|.||:.       |
Human    57 GEEEDEDEDLEEEEEEEE----------EDDD---------QKPKRRGPKKKKMTKARLERFKLR 102

  Fly   270 RIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSAD--- 331
            |::||||||.|:|.::||.:.||:.||.|:.||||||:..||:|.:||..||.:.....|.|   
Human   103 RMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVS 167

  Fly   332 --------QSVPS---IATCLEAVTSTIQTE 351
                    .|.|:   :|.||:....|...|
Human   168 FVQTLCKGLSQPTTNLVAGCLQLNPRTFLPE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
NEUROD1NP_002491.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..94 10/55 (18%)
bHLH_TS_NeuroD1 75..160 CDD:381562 36/93 (39%)
Nuclear localization signal. /evidence=ECO:0000255 87..93 2/5 (40%)
Neuro_bHLH 160..284 CDD:403655 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.