DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and MYF6

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_002460.1 Gene:MYF6 / 4618 HGNCID:7566 Length:242 Species:Homo sapiens


Alignment Length:239 Identity:51/239 - (21%)
Similarity:73/239 - (30%) Gaps:101/239 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LEPLALVT----------TKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEA 237
            |:||.:..          |...|.||..|  ||.|                            ::
Human    22 LQPLEVAEGSPLYPGSDGTLSPCQDQMPP--EAGS----------------------------DS 56

  Fly   238 SLSDEDLNKTGLAPISRPHQ------HQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVP 296
            |..:..|...||.|...|.|      .....|:...:||..|..|||.|:..|:.|:|.|::...
Human    57 SGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTV 121

  Fly   297 AYASTQKLSKLSVLRVACSYILTL---------------------------SRMAGEDY------ 328
            |..: |:|.|:.:||.|.|||..|                           ..:.|.|:      
Human   122 ANPN-QRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSS 185

  Fly   329 ---------------------SADQSVPSIATCLEAVTSTIQTE 351
                                 |.|.|..|...||.::..:|.:|
Human   186 QWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
MYF6NP_002460.1 Basic 3..98 CDD:416335 21/105 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 9/61 (15%)
bHLH_TS_MRF4_Myf6 93..156 CDD:381504 22/63 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.