DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and MYF5

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_005584.2 Gene:MYF5 / 4617 HGNCID:7565 Length:255 Species:Homo sapiens


Alignment Length:162 Identity:41/162 - (25%)
Similarity:65/162 - (40%) Gaps:42/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 DQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRN 261
            |:..|::.||.|                      ..:.|:.|..||.:.    ||..   .||..
Human    30 DEFVPRVAAFGA----------------------HKAELQGSDEDEHVR----APTG---HHQAG 65

  Fly   262 Y-----------KNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACS 315
            :           |:.|.:||..|..|||.|:..::.|:|||::......: |:|.|:.:||.|..
Human    66 HCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPN-QRLPKVEILRNAIR 129

  Fly   316 YILTLSRMAGEDYSADQSVPSIATCLEAVTST 347
            ||.:|..:..|......|:|. .:|.|..:.|
Human   130 YIESLQELLREQVENYYSLPG-QSCSEPTSPT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/50 (38%)
MYF5NP_005584.2 BASIC 1..88 CDD:128794 17/86 (20%)
HLH 84..135 CDD:278439 19/51 (37%)
Myf5 143..214 CDD:289036 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.