DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and sage

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:313 Identity:74/313 - (23%)
Similarity:116/313 - (37%) Gaps:106/313 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ASSESEGGDD---LVVEHARSGSPDIRPKGTDSADSKPIALVRNKRKSSEPFKVVGLTTPNSKSM 100
            :|:....||.   ||...|.:|.|.:      |..|:      .:.:|||...::.|..|.|.|.
  Fly     7 SSTAGVPGDPPPVLVPVSATTGGPYL------SGGSE------GEAESSEQPVLLELGAPQSSSC 59

  Fly   101 PGPPSSASMNATGPLKKRIRYTSSADSAVVLTPPAIDSPPPNSCIPST-------------LRLQ 152
            |    :.|:|          ||.:||.|.:|   |.....|:|..||.             |...
  Fly    60 P----AVSLN----------YTLTADGAGLL---AYAPTHPHSYSPSVMGGYEKEAHNMGLLPPT 107

  Fly   153 HEIMPNPAHIYVRHPG-VTTLHRSLAAHPEQLE---PLALVTTKKQCVDQAGPKIEAFSALLIGK 213
            :.::|.|..::  |.| |.|      ..|..||   |..||..         |...::|...|  
  Fly   108 YSVIPQPVSMW--HAGQVAT------GSPVGLECNKPSELVPP---------PMYMSYSGGSI-- 153

  Fly   214 QPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYK----NMTRERRIEAN 274
                                   |:.::.|:.|          :|...::    .|.::.|..|.
  Fly   154 -----------------------ANSTEVDIAK----------EHNPAWREKALQMEKDYRRTAC 185

  Fly   275 ARERTRVHTISAAYETLRQAVP-AYASTQKLSKLSVLRVACSYILTLSRMAGE 326
            .|||||:..::.|::.||..:| :..:.:|.||:..||:|.:||..|..|..|
  Fly   186 DRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/51 (37%)
sageNP_524287.1 HLH 181..233 CDD:278439 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.