DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and ato

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster


Alignment Length:237 Identity:59/237 - (24%)
Similarity:90/237 - (37%) Gaps:71/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 RYTSSADSAVVLTPPAID--SPPP-----NSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLA 177
            :|....:.:||.|.|||.  |||.     :|.:.:...:.....|.|...|              
  Fly   106 QYGMIMEQSVVSTAPAIPVASPPAVEVMGSSNVGTCKTIPASAGPKPKRSY-------------- 156

  Fly   178 AHPEQLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTL--KERTQKESTSSSFLEASL- 239
                        |.|.|      |...|.|......:.||...|  :|....:..:|:..:.|: 
  Fly   157 ------------TKKNQ------PSTTATSTPTAAAESSASVNLYTEEFQNFDFDNSALFDDSVE 203

  Fly   240 SDEDL----------------------NKTGLAPISRPHQHQRNYKNMT----RERRIEANARER 278
            .||||                      |:...|..|   ..:|..|.:|    |:||:.||||||
  Fly   204 DDEDLMLFSGGEDFDGNDGSFDLADGENQDAAAGGS---GKKRRGKQITPVVKRKRRLAANARER 265

  Fly   279 TRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTL 320
            .|:..::.|::.|||.:|...:.::|||...|::|.:||..|
  Fly   266 RRMQNLNQAFDRLRQYLPCLGNDRQLSKHETLQMAQTYISAL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
atoNP_731223.1 HLH 253..312 CDD:238036 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.