DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and LYL1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_005574.2 Gene:LYL1 / 4066 HGNCID:6734 Length:280 Species:Homo sapiens


Alignment Length:259 Identity:64/259 - (24%)
Similarity:96/259 - (37%) Gaps:88/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PNSKSMPGPPSSASMNATGPLKKRIRYTSSADSAVVLTPPAI------DSPPPNSCIPS----TL 149
            |...:.||||....:...|            .|:....||.:      .|.||...:|:    ||
Human    31 PPKPASPGPPQVEEVGHRG------------GSSPPRLPPGVPVISLGHSRPPGVAMPTTELGTL 83

  Fly   150 R---LQHEIM----PNPAHIYVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGPKIEAFS 207
            |   ||...:    |..|..|..||.:.:::                      :..|||    ||
Human    84 RPPLLQLSTLGTAPPTLALHYHPHPFLNSVY----------------------IGPAGP----FS 122

  Fly   208 ALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIE 272
            ..     ||::  ||.|       .|..|..|::             .||.|:      ..||:.
Human   123 IF-----PSSR--LKRR-------PSHCELDLAE-------------GHQPQK------VARRVF 154

  Fly   273 ANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDYSADQSVPS 336
            .|:|||.|...::.|:..||:.:|.:...:||||..|||:|..||..|.|:..:..:|..:.|:
Human   155 TNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
LYL1NP_005574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60 9/40 (23%)
HLH 156..208 CDD:197674 21/51 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..280 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.