DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Bhlhe22

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001102410.1 Gene:Bhlhe22 / 365748 RGDID:1305451 Length:352 Species:Rattus norvegicus


Alignment Length:92 Identity:34/92 - (36%)
Similarity:48/92 - (52%) Gaps:17/92 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 RIEANARERTRVHTISAAYETLRQAVPAYA---STQKLSKLSVLRVACSYIL----TLSRM---- 323
            |:..|||||.|:|.::.|.:.||..:| ||   |.:||||::.|.:|.:|||    .|..|    
  Rat   215 RLNINARERRRMHDLNDALDELRAVIP-YAHSPSVRKLSKIATLLLAKNYILMQAQALEEMRRLV 278

  Fly   324 ----AGEDYSADQSVPSIATCLEAVTS 346
                .|:..|| .|:||.|....|..:
  Rat   279 AYLNQGQAISA-ASLPSSAAAAAAAAA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 24/56 (43%)
Bhlhe22NP_001102410.1 HLH 219..273 CDD:197674 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.