DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and dimm

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001260674.1 Gene:dimm / 35404 FlyBaseID:FBgn0023091 Length:390 Species:Drosophila melanogaster


Alignment Length:115 Identity:36/115 - (31%)
Similarity:61/115 - (53%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 GKQPSAKKTLKERTQKESTS---SSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEA 273
            |:.||.    :.|.|:.|:.   |:....|.|....|..|.|...|........:||   ||:|:
  Fly   104 GQGPSG----RGRVQQASSGACPSTIAPNSTSSNSSNANGNASRRRKGALNAKERNM---RRLES 161

  Fly   274 NARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM 323
            |.|||.|:|:::.|:::||:.:|.....::|||:..|.:|.:||:.|:.:
  Fly   162 NERERMRMHSLNDAFQSLREVIPHVEMERRLSKIETLTLAKNYIINLTHI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 20/50 (40%)
dimmNP_001260674.1 HLH 154..208 CDD:238036 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.