DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and amos

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:233 Identity:61/233 - (26%)
Similarity:90/233 - (38%) Gaps:57/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PGPPSSASMNATGPLKKRIRYT---SSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHI 162
            |..|...| |.|....:::.|.   |::||         .|...|||              ...:
  Fly    18 PAIPEFLS-NDTFQQLEQLMYQQEFSTSDS---------QSDGANSC--------------SLEM 58

  Fly   163 YVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGP--KIEAFSALLIGKQPSAKKTLKERT 225
            |...|.|..|...|.|..:|...|           ||.|  |.:..|.....||..:|.     .
  Fly    59 YYDTPSVLELEHMLNAQEQQQHHL-----------QANPLGKNQGRSPRYWNKQQRSKP-----Y 107

  Fly   226 QKESTSSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYET 290
            .|.|||.|...:|.|....:..|..            ..:.::||:.||||||.|:::::.|::.
  Fly   108 DKLSTSMSSSTSSASSSSSSSAGFG------------GEVLKKRRLAANARERRRMNSLNDAFDK 160

  Fly   291 LRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGEDY 328
            ||..||:....::|||...|::|.:||..|..:...||
  Fly   161 LRDVVPSLGHDRRLSKYETLQMAQAYIGDLVTLLSRDY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 21/50 (42%)
amosNP_477446.1 HLH 137..195 CDD:238036 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446153
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.