DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Oli

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001188830.1 Gene:Oli / 35066 FlyBaseID:FBgn0032651 Length:232 Species:Drosophila melanogaster


Alignment Length:195 Identity:50/195 - (25%)
Similarity:83/195 - (42%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PSTLRLQHEIMPNPAHIYV---------RHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQAGP 201
            ||.|......:||..|:.:         :||..|       |.|.|..|     .::..:...| 
  Fly     3 PSNLAFGFPGLPNHGHMPIPPTANMLGGQHPAPT-------ASPPQSVP-----GRRTPLGSVG- 54

  Fly   202 KIEAFSALLIG--KQPSAKKTLKERTQKES----TSSSFLEASLSDED----LNKTGLAPISRPH 256
             :..|.|..:|  :||...:.....:..|.    |:::....::|...    ::..|.:......
  Fly    55 -LGGFYAQGMGMSQQPPTDENKPGPSAPEKPLSPTAAAIAAIAISGGTTTVAVSSGGASGSGSNS 118

  Fly   257 QHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYA---STQKLSKLSVLRVACSYIL 318
            ..|:|.:..|  .|:..|||||.|:|.::.|.:.||..:| ||   |.:||||::.|.:|.:|||
  Fly   119 GKQKNRQGKT--VRLNINARERRRMHDLNDALDELRSVIP-YAHSPSVRKLSKIATLLLAKNYIL 180

  Fly   319  318
              Fly   181  180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 24/53 (45%)
OliNP_001188830.1 HLH 134..188 CDD:197674 23/48 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19290
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.