DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and neurog1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571116.1 Gene:neurog1 / 30239 ZFINID:ZDB-GENE-990415-174 Length:208 Species:Danio rerio


Alignment Length:131 Identity:40/131 - (30%)
Similarity:64/131 - (48%) Gaps:25/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 TSSSFLEASLSDEDLNKTGLAPIS------RP-------HQHQR---NYKNMT------RERRIE 272
            |||.....|.:|::.:::.|.|.|      :|       .|.:|   ..:|.|      :.||::
Zfish    10 TSSCDYSFSHTDDEDSRSSLHPASPASSCGKPPASPAGLQQKKRRRGRARNETTVHVVKKNRRLK 74

  Fly   273 ANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLS---RMAGEDYSADQSV 334
            ||.|||.|:|.::.|.:.||..:||:....||:|:..||.|.:||..||   |:|.:.....:..
Zfish    75 ANDRERNRMHNLNDALDALRSVLPAFPDDTKLTKIETLRFAHNYIWALSETIRIADQKQGKSRDG 139

  Fly   335 P 335
            |
Zfish   140 P 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
neurog1NP_571116.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 12/51 (24%)
CCDC106 <20..>102 CDD:292422 23/81 (28%)
HLH 68..127 CDD:238036 24/58 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.