DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and neurod1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571053.1 Gene:neurod1 / 30169 ZFINID:ZDB-GENE-990415-172 Length:350 Species:Danio rerio


Alignment Length:185 Identity:56/185 - (30%)
Similarity:84/185 - (45%) Gaps:41/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ALLIGKQPSAKKTLK--ERTQKESTSSSFLEASLSD-EDLNKTGLAPI----------------- 252
            ::::..|.|:..|.|  ..:|.|.......|..|:| ||.:..||..:                 
Zfish     9 SMMLESQSSSNWTDKCHSSSQDERDVDKTSEPMLNDMEDDDDAGLNRLEDEDDEEEEEEEEDGDD 73

  Fly   253 SRPHQHQRNYKNMTRE-------RRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVL 310
            ::|.:.....|.||:.       ||::||||||.|:|.::.|.|:||:.||.|:.||||||:..|
Zfish    74 TKPKRRGPKKKKMTKARMQRFKMRRMKANARERNRMHGLNDALESLRKVVPCYSKTQKLSKIETL 138

  Fly   311 RVACSYILTLSRMAGEDYSAD-----------QSVPS---IATCLEAVTSTIQTE 351
            |:|.:||..||.:.....|.|           .|.|:   :|.||:....|...|
Zfish   139 RLAKNYIWALSEILRSGKSPDLMSFVQALCKGLSQPTTNLVAGCLQLNPRTFLPE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 28/50 (56%)
neurod1NP_571053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 17/81 (21%)
Nuclear localization signal. /evidence=ECO:0000255 82..88 2/5 (40%)
HLH 95..153 CDD:238036 30/57 (53%)
Neuro_bHLH 155..277 CDD:289310 9/39 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.