DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurog1

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_062080.1 Gene:Neurog1 / 29410 RGDID:3167 Length:244 Species:Rattus norvegicus


Alignment Length:157 Identity:41/157 - (26%)
Similarity:70/157 - (44%) Gaps:37/157 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 QLEPLALVTTKKQCVDQAGPKIEAFSALLIGKQPSAKKTLKERTQKESTSSSFLEASLSDEDLNK 246
            :|:|||..:.......::.|.:...|.:     |..:...:||.::...:....||.|       
  Rat    35 RLQPLASTSGLSVPARRSAPTLSGASNV-----PGGQDEEQERRRRRGRARVRSEALL------- 87

  Fly   247 TGLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLR 311
                            .::.|.||::||.|||.|:|.::||.:.||..:|::....||:|:..||
  Rat    88 ----------------HSLRRSRRVKANDRERNRMHNLNAALDALRSVLPSFPDDTKLTKIETLR 136

  Fly   312 VACSYILTLS---RMAGEDYSADQSVP 335
            .|.:||..|:   |:      |||.:|
  Rat   137 FAYNYIWALAETLRL------ADQGLP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 22/50 (44%)
Neurog1NP_062080.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..84 5/45 (11%)
bHLH_TS_NGN1_NeuroD3 83..154 CDD:381559 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.