DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Olig3

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001099739.1 Gene:Olig3 / 293012 RGDID:1305997 Length:273 Species:Rattus norvegicus


Alignment Length:136 Identity:39/136 - (28%)
Similarity:65/136 - (47%) Gaps:37/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LIGKQPSAKKTLKERTQKESTSSS--FLEASLSDEDLNKTGLAPISRPHQHQRNYKNMTRERRIE 272
            ::.|.|.  ::|.....|.:..||  .::..||::||                      ::.|::
  Rat    48 MVQKMPG--ESLSRAGAKAAGESSKYKIKKQLSEQDL----------------------QQLRLK 88

  Fly   273 ANARERTRVHTISAAYETLRQAVPAYA---STQKLSKLSVLRVACSYILTLS-------RMAGED 327
            .|.|||.|:|.::.|.:.||:.:| ||   |.:||||::.|.:|.:|||.|:       |:.||.
  Rat    89 INGRERKRMHDLNLAMDGLREVMP-YAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGEI 152

  Fly   328 YSADQS 333
            |....|
  Rat   153 YGGHHS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 23/53 (43%)
Olig3NP_001099739.1 bHLH_TS_OLIG3 70..150 CDD:381511 29/102 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.