DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Neurod4

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001099412.2 Gene:Neurod4 / 288821 RGDID:1310434 Length:330 Species:Rattus norvegicus


Alignment Length:152 Identity:46/152 - (30%)
Similarity:73/152 - (48%) Gaps:27/152 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 SAKKTLKERTQKEST----------SSSFLEASLSDEDLNKTGLAPISRPHQHQRNYKNMT---- 266
            |::..::|:.::..:          ..|..|....:||.:|        |.:.....|.||    
  Rat    26 SSQNEMEEQERRPGSYGMLGTLMEEHDSIEEEEEEEEDGDK--------PKRRGPKKKKMTKARL 82

  Fly   267 ---RERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRM--AGE 326
               |.||::||||||||:|.::.|.:.||:.:|.|:.||||||:..||:|.:||..||.:  .|:
  Rat    83 ERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKTQKLSKIETLRLARNYIWALSEVLETGQ 147

  Fly   327 DYSADQSVPSIATCLEAVTSTI 348
            .......|..:...|...||.:
  Rat   148 TLEGKGFVEMLCKGLSQPTSNL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 27/50 (54%)
Neurod4NP_001099412.2 bHLH_TS_NeuroD4_ATOH3 59..145 CDD:381564 37/93 (40%)
Neuro_bHLH 146..263 CDD:403655 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.