DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Tcf12

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_037308.1 Gene:Tcf12 / 25720 RGDID:3829 Length:707 Species:Rattus norvegicus


Alignment Length:439 Identity:92/439 - (20%)
Similarity:146/439 - (33%) Gaps:154/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SASELSAIIMKDSPNSNDRDA-----GFCSASSESEGGDDLVVEHARSGSPDIRPKGTDSADSKP 73
            |.|....:....:|..|..|:     |  :|:..|:.||.|....|...|||.......|..|.|
  Rat   301 STSSSPYVAASHTPPINGSDSILGTRG--NAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTP 363

  Fly    74 IALVRNKRKSSEPFKVVGLTTPNSKSMP-----GPPSSASMNATGPLKKRI-------------- 119
            :.       |..|.      |..:...|     .|.|.:..|:...||.|:              
  Rat   364 VG-------SPSPL------TAGTSQWPRAGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSF 415

  Fly   120 ------------RYTSSADSAVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAH----------- 161
                        |.....|:..||...|:.   |::.:|::....|.:: .|:|           
  Rat   416 LKDVCEQSRMEDRLDRLDDAIHVLRNHAVG---PSTSLPTSHSDIHSLL-GPSHNAPIGNLNSNY 476

  Fly   162 ------IYVRHPGVTTLHR---------------SLAAHPEQLE-------------------PL 186
                  ...|...:...||               ::||...:|.                   |.
  Rat   477 GGSSLVTNSRSASMVGTHREDSVSLNGNHSVLSSTVAASNTELNHKTPESFRGGVQNQSGSVVPT 541

  Fly   187 ALVTTKKQCVDQAGPKIEAFSALLIGKQPSA--KKTLKERTQKESTSSSFLEASLS--DEDLNKT 247
            .:.|..|:..:.            :.:.||:  .|:..|.:||:...||....|.:  |||||  
  Rat   542 EIKTENKEKDEN------------LHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLN-- 592

  Fly   248 GLAPISRPHQHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQK-LSKLSVLR 311
                   |.|.....|    |||:..|||||.||..|:.|::.|.:....:..::| .:||.:|.
  Rat   593 -------PEQKIEREK----ERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILH 646

  Fly   312 VACSYILTLSRMAGEDYSADQSVPSIATCLEAVTSTIQTEGKVKRKKDE 360
            .|.:.||:|.:...|     :::...|.||             ||:::|
  Rat   647 QAVAVILSLEQQVRE-----RNLNPKAACL-------------KRREEE 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/51 (37%)
Tcf12NP_037308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..109
Leucine-zipper 119..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..313 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 349..393 11/56 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..605 22/108 (20%)
HLH 608..661 CDD:197674 18/52 (35%)
Class A specific domain 657..680 7/39 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 675..707 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.