DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Myf6

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_037304.1 Gene:Myf6 / 25714 RGDID:3134 Length:242 Species:Rattus norvegicus


Alignment Length:112 Identity:34/112 - (30%)
Similarity:53/112 - (47%) Gaps:14/112 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 PSAKKTL---KERTQKESTSSSFLEASLSDEDLNKTGLAPISRPHQ------HQRNYKNMTRERR 270
            |.:..||   :::..:|:.|.|    |..:..|...||.|...|.|      .....|:...:||
  Rat    35 PGSDGTLSPCQDQMPQEAGSDS----SGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRR 95

  Fly   271 IEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYI 317
            ..|..|||.|:..|:.|:|.|::...|..: |:|.|:.:||.|.:||
  Rat    96 KAATLRERRRLKKINEAFEALKRRTVANPN-QRLPKVEILRSAINYI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 20/49 (41%)
Myf6NP_037304.1 Basic 3..93 CDD:279868 14/61 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 7/31 (23%)
HLH 94..145 CDD:278439 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.