DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Ascl2

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:200 Identity:53/200 - (26%)
Similarity:83/200 - (41%) Gaps:47/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 AIDSPPPNSCIPSTLRLQHEIMPNPAHI-YVRHPGVTTLHRSLAAHPEQLEPLALVTTKKQCVDQ 198
            |.|:.|..|| .|.|....|    .|:: :..|| |...|.|..|.    :|:|........:..
  Rat    16 ASDACPRESC-SSALPEARE----GANVHFPPHP-VPREHFSCGAP----KPVAGAPALNASLMD 70

  Fly   199 AG--PKIEAFSALLIG-----KQPSAKKTLKERTQKESTSSSFLEASLSDEDLNKTGLAPISRPH 256
            .|  |::...|:.:.|     ::|.:.:.|:...::.|.::   |||.|.        |.::|  
  Rat    71 GGALPRLVPTSSGVAGACTARRRPPSPELLRCSRRRRSGAT---EASSSS--------AAVAR-- 122

  Fly   257 QHQRNYKNMTRERRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLS 321
                            .|.|||.||..::..::.|||.||...:.:||||:..||.|..||..|.
  Rat   123 ----------------RNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYIRALQ 171

  Fly   322 RMAGE 326
            |:..|
  Rat   172 RLLAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 20/50 (40%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 11/69 (16%)
HLH 134..176 CDD:197674 16/41 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.