DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and Tal2

DIOPT Version :10

Sequence 1:NP_524820.2 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:58 Identity:23/58 - (39%)
Similarity:35/58 - (60%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 RRIEANARERTRVHTISAAYETLRQAVPAYASTQKLSKLSVLRVACSYILTLSRMAGE 326
            |:|..|.|||.|..:::.|:..||:.:|.:...:||||...||:|..||..|.::.||
Mouse     3 RKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGE 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_524820.2 bHLH_TS_ATOH8 262..329 CDD:381427 23/58 (40%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 23/58 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.