DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment net and hlh-6

DIOPT Version :9

Sequence 1:NP_001259789.1 Gene:net / 45339 FlyBaseID:FBgn0002931 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_496070.1 Gene:hlh-6 / 188539 WormBaseID:WBGene00001952 Length:268 Species:Caenorhabditis elegans


Alignment Length:221 Identity:52/221 - (23%)
Similarity:87/221 - (39%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AVVLTPPAIDSPPPNSCIPSTLRLQHEIMPNPAHIYVRHPGVTTLHRSLAAHPEQL--------- 183
            :.::....|.:|.||.       :||.|.   .||....|....|..::....::|         
 Worm    24 STIINQNTIQTPIPNP-------IQHHIQ---NHIQTSIPNTNLLLENVQTDVQKLMVPLIDQQF 78

  Fly   184 -----EPLALVTTKKQCVDQAGPKIEAFSALLIGKQP------SAKKTLKERTQKESTSSSFLEA 237
                 .||.|.....|...|..|:|   |.:.|..||      ..:..|..::|.:.:|.:.|:.
 Worm    79 HIPTSTPLQLAPIPTQIQSQLQPQI---SQIPIHNQPQIQIQSQVQPQLPTQSQPKPSSKASLDT 140

  Fly   238 SLSDEDLNKTGLAP---ISRPHQHQRNYKNMTRE--RRIEANARERTRVHTISAAYETLRQAVPA 297
            |.:.........||   :..|.:.:..|...:..  :|   |.|||.||..::..||.||:.:|.
 Worm   141 SSNAFKKYVNPFAPEATVPLPVELEDQYGPYSSSVWKR---NERERCRVRNVNDGYERLRKHLPV 202

  Fly   298 YASTQKLSKLSVLRVACSYILTLSRM 323
            :...:::||:..||:|..||..|..:
 Worm   203 HFDEKRISKVDTLRLAIRYIKHLDNL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
netNP_001259789.1 HLH 269..320 CDD:278439 19/50 (38%)
hlh-6NP_496070.1 HLH 179..231 CDD:197674 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.